Dr. Murat Çağatay Deniz

OBEZ HASTANIN DEĞERLENDİRİLMESİ

Bu bölümde, obez bir hastanın değerlendirilmesi ve hastaya yaklaşım özetlenecektir. Anamnezde sorulması gereken önemli konular, fizik muayenede dikkat edilecek noktalar ayrıntılı olarak belirtilmiş ve laboratuvar testleri özetle anlatılmıştır. Genel olarak, obez bir hastaya yaklaşımda; obezite ilişkili anamnez alınmalı, obezitenin derece ve tipini tayin edecek şekilde fizik muayene yapılmalı, sekonder obezite nedenleri ve obezitenin komplikasyonları araştırılmalıdır.

Anamnez

Hastanın obezitesi ile ilgili geniş ve ayrıntılı bir anamnez alınmalı ve aşağıdaki durumlar sorgulanmalıdır.

  • Obezitenin başlama yaşı, süresi ve başvurusu sırasındaki belirtiler öğrenilmelidir.
  • Hastanın hangi ırktan olduğu bilinmelidir.
  • Aile hikayesi: Ailede ve özellikle anne, baba ve kardeşler gibi 1. derece akrabalarda, obezite ve ilişkili hastalıklar (Tip 2 Diyabet, HT, KVH, dislipidemi ve OSAS gibi) sorgulanmalıdır.
  • Beslenme alışkanlıkları ve yeme davranışı dahil, ayrıntılı bir beslenme anamnezi (örn; öğle yemeği yiyor mu?) alınmalıdır.
  • Günlük diyetinde ayak üstü hızlı yenen gıdalar, kızarmış yiyecekler, kırmızı et yeme alışkanlıkları, beslenme programında sebze ve meyveler var mı?
  • Haftada kaç öğün dışarıda yemek yiyor?
  • Yemek arası atıştırmaları var mı ve öğünleri atlıyor mu?
  • Alkol kullanıyor mu, kullanıyorsa günde kaç birim alıyor?
  • Sigara içiyor mu?
  • Madde alışkanlığı var mı?
  • Muhtemel bir yeme bozukluğu varlığı (binge eating [tıkınırcasına yeme] bozukluğu, gece yeme sendromu, anoreksiya nervoza ve bulimia gibi) tespit edilmelidir.
  • Daha önceki kilo verme girişimleri (başarılı olup olmadığı), kilo kaybını teşvik eden yeni faktörler ve yeterli sosyal destek sistemi sorgulanmalıdır.
  • Aşırı yemeyi teşvik eden zaman kısıtlılığı, stres ve diğer faktörler gibi sağlıklı yaşam tarzını etkileyebilen spesifik davranışlar sorgulanmalıdır.
  • Şaşkınlık, öfke, inkar veya tedaviye inançsızlık gibi faktörlerin tedaviye uyumu ve gönüllü katılmayı olumsuz olarak etkileyebileceği göz önüne alınmalıdır.
  • Depresyon ve diğer duygu durum bozuklukları sorgulanmalıdır.

Bu grup hastalıklar, 40 yaş üzeri ve BKİ ≥30 kg/m2 olan obez hastaların %20-60’ında görülür. Duygu durum bozukluğu varlığı, kilo kaybı sağlamaya yönelik tedavi girişimlerini olumsuz yönde etkiler. Dolayısıyla, bu girişimler ile birlikte majör depresif bozukluğun tedavisi de yapılmalıdır. Antidepresan ilaç alan hastalarda, bazı kilo kaybettirici ilaçların kullanılmasından kaçınılmalıdır.

  • Kilo kaybı tedavisine başlamadan önce, yaşam tarzı değişiklikleri için hastanın tedavi girişimlerine karşı istekli ve gönüllü olması şarttır. Bu durumun değerlendirilmesinde;

a) Kilo kaybı için nedenler,
b) Hastanın tedaviden beklentileri, hedefleri ve motivasyon düzeyi,
c) Önceki kilo kaybı girişimleri,
d) Aile ve arkadaşlardan beklenen destek,
e) Risk ve yararlarını anlayığ anlamadığını,
f) ) Uygun zamanın varlığı ve ekonomik kısıtlılıklar dahil, tüm güçlü engeller var mı, sorgulanmalıdır.

  • Fizik aktivite-egzersiz anamnezi:
  • Egzersiz sıklığı (haftada egzersiz yapılan gün sayısı)
  • Egzersiz yoğunluğu (hafif, orta derecede veya ağır-şiddetli)
  • Egzersiz süresi (seans süresi)
  • Hastanın belirli bir egzersiz yapma gücünü engelleyebilen veya yasaklayabilen fiziksel kısıtlamalar var mı?
  • Obeziteye yol açan diğer risk faktörleri (cinsiyet, yaş, eğitim düzeyi, meslek, medeni durum, aylık gelir düzeyi, gebelik ve doğum sayısı, sigarayı bırakma, alkol kullanımı, psikososyal faktörler ve kronik stres gibi),
  • Sekonder obeziteye yol açan ilaçlar ve hastalıklara (Tablo 3.1) ait belirtiler,
  • Obezitenin komplikasyonları ve komorbid durumlara (Tablo 3.2) ait belirtiler sorgulanmalıdır.

Fizik muayene

  • Hastanın sistemik fizik muayenesi yapılmalıdır.
  • Boy ve ağırlık ölçümleri, çocuk ve adolesanlarda büyüme eğrileri ile karşılaştırma yapılmalıdır.
  • BKİ’nin hesaplanması ve obezite derecesinin sınıflandırılması,
  • Bel çevresi ölçümü,
  • Kan basıncı ölçümü (manşon boyutları, uygun bir tansiyon aleti ile),
  • Nabız muayenesi,
  • Cilt muayenesi (insülin direncinin bir bulgusu olarak boyun ve aksillada akantozis nigrikans),
  • Sekonder obezite nedeni olabilecek hastalık ve durumlara (Tablo 3.1) ilişkin bulgular (hipotiroidi, Cushing sendromu, PKOS ve genetik sendromlar gibi),
  • Obezite ile ilişkili hastalıklar ve komorbid durumlara (Tip 2 Diyabet, HT, dislipide mi, kardiyovasküler ve respiratuvar hastalıklar, eklem hastalıkları, non-alkolik yağlı karaciğer hastalığı (NAFLD) ve uyku bozuklukları gibi) ait bulgular (Tablo 3.2 ve 3.3) değerlendirilmelidir.
  • Anamnez ve fizik muayenede endokrin hastalık belirti ve bulgusu yoksa, rutinde endokrin inceleme ve araştırma önerilmez.

Sekonder obezite nedenleri ve özellikleri

Genetik obezite

1. Laurence-Moon Biedl sendromu: Mental gerilik, retinitis pigmentoza, polidaktili, hipogonadotropik hipogonadizm ve progresif generalize obezite.
2. Prader-Willi sendromu: Boy kısalığı, mental gerilik, hipogonadotropik hipogonadizm, hipotoni, küçük el ve ayaklar, balık ağız, hiperfaji ve progresif generalize obezite.
3. Alström sendromu: Retinis pigmentozaya bağlı körlük, nörosensoriyel sağırlık, gonadal yetersizlik, insülin direncinin eşlik ettiği diyabet, gövdesel obezite, boy kısalığı, küçük el ve ayaklar, taban düşüklüğü, diş gelişiminde bozukluk, akantozis nigrikans, böbrek yetersizliği, karaciğer hastalığı, tekrarlayan akciğer enfeksiyonları ve kardiyomiyopati.
4. Cohen sendromu: Mikrosefali, yüz anomalileri, mental gerilik, boy kısalığı, gövdesel obezite, hipogonadizm, hipotoni ve küçük (dar) el ve ayaklar.
5. Carpenter sendromu: Gelişme geriliği, erkek hipogonadizmi, polidaktili, sindaktili, akrosefali, gövdesel ve gluteal obezite.
6. Albright’ın herediter distrofisi
7. Konjenital makrozomiya adipozitas
8. Von Gierke hastalığına eşlik eden obezite
9. Ailevi (familiyal) hipoglisemi sendromu
10. Rotmund sendromu
11. Hiperostoz frontalis internaya eşlik eden obezite

I. Hipotalamik obezite

1. Adipoza-genital distrofi (Fröhlich sendromu): Diabetes insipidus, görme bozukluğu, mental gerilik, obezite, hipogonadotropik hipogonadizm
2. Kleine-Levin sendromu
3. Tokluk merkezi (ventromediyal hipotalamus)’nin harabiyeti: tümör, travma veya inflamasyon

II. Endokrin hastalıklarda görülen obezite

1. Cushing sendromu
2. Hipotiroidi
3. İnsülinoma
4. PKOS
5. Erkek hipogonadizmi
6. GH eksikliği veya direnci (hipotalamo-hipofizer cücelik)
7. Turner sendromu
8. Kraniyofarinjiyoma ve hipotalamusu tutan diğer hastalıklar
9. Hipofiz yetmezliği

III. İlaç ve hormonlara bağlı kilo artışı

1. Antipsikotikler/nöroleptikler
2. Antidepresanlar (trisiklik, monoaminoksidaz inhibitörleri, paroksetin ve mirtazapin)
3. Antiepileptikler (valproat, gabapentin, karbamazepin)
4. Lityum
5. Fenotiyazinler
6. Steroid hormonlar: kortikosteroidler, progestasyonel steroidler, hormonal kontraseptifler)
7. Antidiyabetikler: insülin, sulfonilüreler ve tiyazolidinedionlar
8. Nonsteroid anti-inflamatuvar ilaçlar ve kalsiyum kanal blokerleri,  ve -adrenerjik reseptör blokerleri (vücut yağı artmaz, periferik ödeme neden olabilir)

Obezite ile ilişkili sağlık riskleri ve tıbbi komplikasyonlar

Kardiyovasküler

Koroner arter hastalığı Miyokard infarktüsü
Konjestif kalp yetersizliği ve kor pulmonale Ani ölüm
Serebrovasküler olaylar (inme vb.) Hipertansiyon
Sol ventrikül hipertrofisi
Varisler, derin ven trombozu ve pulmoner tromboemboli

Metabolik

İnsülin direnci Tip 2 Diyabet Dislipidemi
Metabolik sendrom Kolesterol safra taşları Hiperürisemi, gut
Düşük dereceli inflamasyon

Kanser

Özefagus, ince barsak, kolon, rektum, karaciğer, safra kesesi, pankreas, böbrek, lösemi, multipl miyelom ve lenfoma
Erkek: prostat
Kadın: meme, over, endometriyum ve serviks

Hormonal

PKOS, mens bozuklukları, hiperandrojenizm Akantozis nigrikans
İnfertilite
Seks hormon bağlayıcı globülin düzeyinde azalma Östrojenlerde azalma
Erkeklerde testosteron düzeyinde azalma Büyüme hormonunda azalma
Prolaktin cevabında azalma Kortizol yapımında artma

Romatolojik

Osteoartrit (özellikle diz ve kalçalarda)
Tuzak nöropatileri (karpal tünel sendromu)
İmmobilite

Pulmoner

Fonksiyonel rezidüel kapasite, ekspiratuvar rezerv volüm ve total akciğer kapasitesinde azalma Residüel volüm ve diffüzyon kapasitesinde artma
Erkeklerde maksimum ekspiratuvar akış hızında azalma
OSAS, obezite-hipoventilasyon sendromu (Pickwickian sendromu) ve astım

Gastrointestinal

Safra kesesi hastalığı (kolelitiyaz) NAFLD veya NASH Gastroözofajiyal reflü hastalığı Herni

Üriner

Üriner stres inkontinensi Obezite ile ilişkili glomerülopati

 

Obezite ile ilişkili sağlık riskleri ve tıbbi komplikasyonlar

Çeşitli

İdiyopatik intrakraniyal hipertansiyon, demans Proteinüri, nefrotik sendrom
Cilt enfeksiyonları, selülit, intertrigo, karbünkül
Lenfödem, bacaklarda staz hiperpigmentasyonu, akantozis nigrikans/papillomatöz cilt lezyonları (skin tags)
Anestezi komplikasyonları Periodontal hastalık

Psikolojik ve sosyal sonuçlar

Özgüvende azalma, anksiyete ve depresyon
Sosyal damgalanma, sosyal yaşamdan uzaklaşma ve işsizlik Beden imaj bozukluğu

Konsültasyonlar

  • Tıbbi beslenme tedavisi için beslenme uzmanına gönderilmelidir.
  • Göz dibi muayenesi (gerekiyorsa) yapılmalıdır.
  • Psikolog veya psikiyatrist muayenesi (yeme davranışı bozuklukları ve hastanın davranış değişikliği tedavisine hazırlık halini değerlendirmek için) yapılmalıdır.
  • Obezite ile ilişkili komorbid durumların değerlendirilmesi için, diğer uzmanlık alanlarından (kardiyoloji, jinekoloji, FTR, KBB, göğüs hastalıkları, dermatoloji ve gastroenteroloji gibi) konsültasyon istenmelidir.

Laboratuvar incelemeleri

  • Açlık kan plazma glukozu (AKŞ) ölçülmelidir.
  • Tam idrar analizi yapılmalıdır.
  • Açlık serum lipid profili (total kolesterol, HDL-kolesterol, LDL-kolesterol, Total kolesterol/HDL-kolesterol oranı ve trigliserid) alınmalıdır.
  • Serum ürik asit; yaşlılarda ilaveten BUN ve kreatinin düzeyleri ölçülmelidir.
  • Karaciğer enzimleri (ALT, AST, GGT, ALP) ölçülmelidir; yüksek bulunursa US ve biyopsi yapılması gereklidir.
  • EKG ve gerekirse ileri kardiyovasküler inceleme yapılması önerilir.
  • Gerektiğinde ve şüphe varsa sekonder obezite nedeni olabilecek hastalıklara ve obezite ile ilişkili komorbid durumlara ait laboratuvar incelemeleri yapılmalıdır (Tablo 3.3). Örneğin, hipotiroidi şüphesinde serum TSH düzeyinin ölçülmesi, sonuç normal değilse serbest T4 düzeyi ölçülmesi. Cushing sendromu veya hipotalamik hastalık şüphesi varsa ilgili hormonlar istenmeli ve gerektiğinde dinamik endokrin testleri yapılmalıdır.

Beden Kompozisyon Analizi (BKA): Bel çevresi ölçümü, abdominal yağlanmanın pratik bir göstergesidir. BKA, klinik uygulamada mutlak gerekli değildir. Özellikle obez bireylerde biyoelektrik impedans analizi (BİA) gibi ayaktan uygulanan teknikler ile beden kompozisyonu veya kilo.

 

Obez hastalarda semptomlar, risk faktörleri ve kuşkulu bulgulara dayanarak laboratuvar ve tanısal değerlendirme

Hastalık

Önerilen tetkikler

Diyabetes mellitus

AKŞ≥126mg/dL(ikiayrızamandaalınankanörneğinde)veyadiyabetinsemptomlarıilebirlikterastgele≥200mg/dLveya 75 g glukozlu OGTT’de 2. st KŞ≥200mg/dL

veyastandardizemetodlaölçülenA1C>%6,5veyahastaanti-hiperglisemikilaçkullanıyorsa(bilinendiyabet)

Kan basıncı ölçümü ve açlık lipid profili

Hipertansiyon

İki veya daha fazla doktor muayenesinde usulüne uygun olarak ölçülenikiveyadahafazlaölçümünortalamasıSKB≥140mmHg

ve/veyaDKB≥90mmHg (preHT: SKB=120-139mmHgve/veya DKB =80-89mmHg)

veya hasta anti-hipertansif ilaç kullanıyorsa (bilinen hipertansiyon) hemogram, idrar analizi, açlık lipid profili dahil kan biyokimyası ve EKG

Metabolik sendrom

IDF, IASveIASOkriterleri(2009)(Enazüçkriterinvarlığı): Abdominal obezite (BÇ, erkekte ≥94 cm, kadında ≥80 cm), AKŞ≥100mg/dLveyadahaönce Tip 2Diyabettanısı,

KB ≥130/85 mmHg ve/veya ilaç tedavisi altında HT,

TG≥150mg/dLveyailaçtedavisialtındahipertrigliseridemi,HDL-kolesterolerkekte<40mg/dLvekadında<50mg/dL

OSAS

Gündüz aşırı uyku hali, uykuda gürültülü horlama,apnevehipopneataklarıçarpıntıve nefesin kesilmesi(tıkanma)

Sabah ortaya çıkan baş ağrıları

Hafıza ve konsantrasyonda zayıflama Duygu durum değişikliği (depresyon, anksiyete) Kişilik değişiklikleri, saldırganlık, irritabilite

Boyunçevresi(erkekte≥43cm,kadında≥41cm) Polisomnografi, uykuda O2 satürasyonuölçülmesi

parmak veya kulak puls oksimetre

Solunum fonksiyon testi ve Akım-volüm eğrisi

ÜstsolunumyolutıkanıklığıiçinKBBmuayenesiKanbasıncıölçümü

Obezite-hipoventilasyon sendromu Hipersomnolans, sağ kalp yetmezliği Takipne ve yüzeyel solunum

Polisomnografi (OSAS dışlaması için) Hemogram (polisitemi dışlanması için) Kan gazları (hipoksi, hiperkapni) Teleradyografi (kardiyomegali)

EKG (sağ atrium ve sağ venrikülde büyüme)

Akciğer fonksiyon testleri (total akciğer kapasitesi, vital kapasite, ekspiratuvar rezerv volüm ve fonksiyonel rezidüel kapasitede azalma, erkeklerde MEF oranında azalma. Rezidüel volüm ve diffüzyon kapasitesinde artma)

PKOS

oligomenore,hirsutizm,akne muhtemel obezite, prediyabet androjenikalopesi

Serbestvetotaltestosteron,PRL,DHEAS,17-hidroksiprogesteron, LH, FSH, TSH LH/FSH oranı, pelvikUS

Lipid profili

Hepatomegali/NAFLD

KC fonksiyon testleri normal×1-4 kat Genellikle ALT >AST, serumbilirubin, PT, Hipoalbüminemi, US veya BT,

Viralhepatit,otoimmün KC hastalığıvekonjenital KC hastalığıyokluğu ile birlikte alkol alımınınolmaması

Kesin tanı için gerekirse KC biyopsisi

 

Safra kesesinde taş

KC fonksiyon testleri (serum bilirubin ve ALP’de yükselme), safra yolları US veya BT

Cushing sendromu

İnce cilt, ay dede yüzü, yorgunluk, kolay ekimozoluşumu,morrenkliciltaltıçatlakları,proksimal kaszafiyeti

Gece oral tek doz 1 mg DST veya Gece tükrük kortizol ölçümü veya

24 saatlik idrarda serbest kortizol ölçümü

Hipotiroidi

Serum TSH ölçümü

IDF: International Diabetes Federation, IAS: International Atherosclerosis Society, IASO: International Association for the Study of Obesity, MEF: Maksimal ekspiratuvar akış.

Kushner RF, RothJL.Assessmentoftheobesepatient.EndocrinolMetabClinNorthAm.2003;32:915-33’denmodifiyeedilmiştir.

kaybındaki değişikliklerin ölçülmesinin geçerliği belirsizdir. Bu nedenle, genel yağlanma belirteci olarak BKİ’nin yerine kullanılması önerilmemektedir. Dual-X-ray absorpsiyometri (DEXA) öl- çümü, bazı özel merkezlerde kullanılmaktadır ve beden kompozisyonunun değerlendirilmesinde daha uygun bir yöntem olabilir. Bu yöntem, yağsız beden kitlesinde dramatik bir azalmaya eşlik eden obezitenin (genetik, endokrinolojik veya nörolojik hastalıklarda ve bariyatrik cerrahi taki- binde) klinik değerlendirilmesinde yararlı olabilir.

Kaynaklar

1. Tsigos C, Hainer V, Basdevant A, et al. Obesity Management Task Force of the European Association for the Study of Obesity. Management of obesity in adults: European Clinical Practice Guidelines. Obes Facts 2008;1:106-16.
2. Lau DC, Douketis JD, Morrison KM, et al. Obesity Canada Clinical Practice Guidelines Expert Panel. 2006 Cana- dian Clinical Practice Guidelines on the Management and prevention of obesity in Adults and Children [Summary]. CMAJ 2007;176:S1-S13.
3. Kushner RF, Roth JL. Assessment of the obese patient. Endocrinol Metab Clin North Am. 2003;32:915-33.
4. Lyznicki JM, Young DC, Riggs JA, Davis RM. Council on Scientific Affairs, American Medical Association. Obe- sity: assessment and management in primary care. Am Fam Physician 2001;63:2185-96.
5. Villareal DT, Apovian CM, Kushner RF, Klein S. American Society for Nutrition; NAASO, fte Obesity Society. Obesity in older adults: technical review and position statement of the American Society for Nutrition and NAASO, fte Obesity Society. Am J Clin Nutr 2005;82:923-34.
6. NICE clinical guideline 43 Obesity: guidance on the prevention, identification, assessment and management of overweight and obesity in adults and children. Issue date: December 2006, pp. 1-84. http://www.nice.org.uk/nice- media/pdf/CG43NICEGuideline.pdf.
7. Calleo-Cross A, Sharma N, Aronne LJ. Medical assessment of obese older patients. Clin Geriatr Med 2005;21:689- 99.

Bu sitede yer alan tüm yazılı ve görsel materyaller drmuratdeniz.com sitesine ve site sahibine aittir. copyright © 2017 - 2019